PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400048386
Common NameLOC102582327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 324aa    MW: 34696.6 Da    PI: 8.1335
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400048386genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822207.73.1e-6421451148
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGtty+kg+kp  + +++g sas+s
  PGSC0003DMP400048386   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYKKGCKPVGHVDIIGYSASVS 90 
                           5899************************************************************************************* PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvss 148
                           p+ss+q        +sp +sy++sp+sssfpsp+s++ + + ++    ++l+p+l++ls+ ss
  PGSC0003DMP400048386  91 PCSSYQ--------PSPGASYNPSPASSSFPSPVSSNYVANVQNnhdpNTLIPWLKNLSSGSS 145
                           ******........9******************999987665555888*********998443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-653141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG  60
WIVEEDGTTY KKGCKPVGHV DIIGYSASVS PCSSYQPSPG ASYNPSPASS SFPSPVSSNY  120
VANVQNNHDP NTLIPWLKNL SSGSSPSSSR FPHHLYIPGS SISAPVTPPL SSPTARTPRM  180
SDDPMANSGW AQQHYAFLPS STPASPGRQT PPDSGWLSGV QTPQDGPSSP TFSLVSPNPF  240
GFKEPISNGG SRMWTPGQSG ACSPAIASGI DQTADVPMSD AISAEFAFGS HMMGLVKPWE  300
GERIHEECAT DDLELTLGNS STR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234075.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
RefseqXP_004234074.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
RefseqXP_006356093.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
RefseqXP_006356092.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
SwissprotQ9ZV881e-132BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLK4BE220.0K4BE22_SOLLC; Uncharacterized protein
TrEMBLM1CNX30.0M1CNX3_SOLTU; Uncharacterized protein
STRINGSolyc03g005990.2.10.0(Solanum lycopersicum)
STRINGPGSC0003DMT4000715110.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-116BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]